Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nurim (NRM)

This Recombinant Human Nurim (NRM) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Nurim, Nuclear envelope membrane protein, Nuclear rim protein

UniProt

Q8IXM6

Expression Region

1-262

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPALLLIPAALASFILAFGTGVEFVRFTSLRPLLGGIPESGGPDARQGWLAALQDRSIL APLAWDLGLLLLFVGQHSLMAAERVKAWTSRYFGVLQRSLYVACTALALQLVMRYWEPIP KGPVLWEARAEPWATWVPLLCFVLHVISWLLIFSILLVFDYAELMGLKQVYYHVLGLGEP LALKSPRALRLFSHLRHPVCVELLTVLWVVPTLGTDRLLLAFLLTLYLGLAHGLDQQDLR YLRAQLQRKLHLLSRPQDGEAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR6380 Mouse qPCR Primer Pair (MI0021911)
MP300815 200 Reactions

MIR6380 Mouse qPCR Primer Pair (MI0021911)

Sign In for Pricing
View Details
ELISA Kit For Fructose-1,6-bisphosphatase 1
E15067b 96 Tests

ELISA Kit For Fructose-1,6-bisphosphatase 1

Sign In for Pricing
View Details
SNORD12B sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2224405 3x 1.0 µg

SNORD12B sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
LOC64038 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV625585 1.0 µg DNA

LOC64038 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
SorLA CRISPR/Cas9 KO Plasmid (h)
sc-403088 20 µg

SorLA CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Recombinant Human SPARC protein (His Tag)
CD00887 10 µg

Recombinant Human SPARC protein (His Tag)

Sign In for Pricing
View Details