Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fat storage-inducing transmembrane protein 2 (FITM2)

This Recombinant Human Fat storage-inducing transmembrane protein 2 (FITM2) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Fat storage-inducing transmembrane protein 2, Fat-inducing protein 2

UniProt

Q8N6M3

Expression Region

1-262

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEHLERCEWLLRGTLVRAAVRRYLPWALVASMLAGSLLKELSPLPESYLSNKRNVLNVYF VKVAWAWTFCLLLPFIALTNYHLTGKAGLVLRRLSTLLVGTAIWYICTSIFSNIEHYTGS CYQSPALEGVRKEHQSKQQCHQEGGFWHGFDISGHSFLLTFCALMIVEEMSVLHEVKTDR SHCLHTAITTLVVALGILTFIWVLMFLCTAVYFHNLSQKVFGTLFGLLSWYGTYGFWYPK AFSPGLPPQSCSLNLKQDSYKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human JPH4 activation kit by CRISPRa
GA113569 1 Kit

Human JPH4 activation kit by CRISPRa

Sign In for Pricing
View Details
ACTG2 (NM_001615) Human Over-expression Lysate
LY419843 100 µg

ACTG2 (NM_001615) Human Over-expression Lysate

Sign In for Pricing
View Details
Myeloperoxidase (MPO) Activity Assay Kit
E-BC-K074-M-01 48 T (24 samples)

Myeloperoxidase (MPO) Activity Assay Kit

Sign In for Pricing
View Details
Myeloperoxidase (MPO) Activity Assay Kit
E-BC-K074-M-02 96 T (48 samples)

Myeloperoxidase (MPO) Activity Assay Kit

Sign In for Pricing
View Details
Her2 (ERBB2) Mouse Monoclonal Antibody [Clone ID: 6C2]
AM06524SU-N 100 µL

Her2 (ERBB2) Mouse Monoclonal Antibody [Clone ID: 6C2]

Sign In for Pricing
View Details
Human ZNF319 activation kit by CRISPRa
GA111594 1 Kit

Human ZNF319 activation kit by CRISPRa

Sign In for Pricing
View Details