Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Nurim (Nrm)

This Recombinant Mouse Nurim (Nrm) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Nurim, Nuclear envelope membrane protein, Nuclear rim protein

UniProt

Q8VC65

Expression Region

1-262

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPALLLVPAALASFILAFGTGVEFVRFTSLRPLLGGIPESGGPDARHGWLAALQDRSIL ASLAWDLCLLLLFVVQHSLMATEAVKAWTSRYFGVLQRSLYVACTALALQLVMRYWETTP RGPVLWEARAEPWATWVPLLCFVLHVVSWLLIFSILLVFDYAELMGLKQVYYHVLGLGEP LSLKSPRALRLFSHLRHPVCVELLTVLWVVPTLGTDRLLLALLFTLYLGLAHGLDQQDLR YLRSQLQRKLHLLSRPQDGEAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYP27A1 Protein Vector (Rat) (pPB-C-His)
PV262754 500 ng

CYP27A1 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Lentiviral human MCM5 shRNA (UAS) - Lentiviral human MCM5 shRNA (UAS, iRFP) (25)
GTR15145406 1 Vial

Lentiviral human MCM5 shRNA (UAS) - Lentiviral human MCM5 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
CD49f Antibody (RPE)
orb435041 100 Tests

CD49f Antibody (RPE)

Sign In for Pricing
View Details
TESK2 Polyclonal Antibody
UB-GEN-14777 100 µL

TESK2 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal Histone H2AX Antibody (RM214) [Alexa Fluor 750]
NBP3-26044AF750 0.1 mL

Rabbit Monoclonal Histone H2AX Antibody (RM214) [Alexa Fluor 750]

Sign In for Pricing
View Details
Human Cystatin-S (CST4) AssayLite™ Antibody (PerCP Conjugate)
33201-05171 5x 30 µg

Human Cystatin-S (CST4) AssayLite™ Antibody (PerCP Conjugate)

Sign In for Pricing
View Details