Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Nurim (Nrm)

This Recombinant Mouse Nurim (Nrm) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Nurim, Nuclear envelope membrane protein, Nuclear rim protein

UniProt

Q8VC65

Expression Region

1-262

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPALLLVPAALASFILAFGTGVEFVRFTSLRPLLGGIPESGGPDARHGWLAALQDRSIL ASLAWDLCLLLLFVVQHSLMATEAVKAWTSRYFGVLQRSLYVACTALALQLVMRYWETTP RGPVLWEARAEPWATWVPLLCFVLHVVSWLLIFSILLVFDYAELMGLKQVYYHVLGLGEP LSLKSPRALRLFSHLRHPVCVELLTVLWVVPTLGTDRLLLALLFTLYLGLAHGLDQQDLR YLRSQLQRKLHLLSRPQDGEAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mmu-miR-3066-5p miRNA Antagomir
CIN0705-01 10 nmol

Mmu-miR-3066-5p miRNA Antagomir

Sign In for Pricing
View Details
Mmu-miR-3066-5p miRNA Antagomir
CIN0705-02 20 nmol

Mmu-miR-3066-5p miRNA Antagomir

Sign In for Pricing
View Details
Recombinant Mouse Orexin receptor type 1 (Hcrtr1)
MBS717699 Inquire

Recombinant Mouse Orexin receptor type 1 (Hcrtr1)

Sign In for Pricing
View Details
Recombinant Geobacter bemidjiensis 60 kDa chaperonin (groL), partial
MBS1255595 Inquire

Recombinant Geobacter bemidjiensis 60 kDa chaperonin (groL), partial

Sign In for Pricing
View Details
RPL17 Antibody Pair
CSB-EAP02504 1 Pair (5x 96 Well Plates)

RPL17 Antibody Pair

Sign In for Pricing
View Details
pBlueScriptR-TEX30 Plasmid
PVT17310 2 µg

pBlueScriptR-TEX30 Plasmid

Sign In for Pricing
View Details