Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Androgen-induced gene 1 protein (Aig1)

This Recombinant Mouse Androgen-induced gene 1 protein (Aig1) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Androgen-induced gene 1 protein, AIG-1

UniProt

Q9D8B1

Expression Region

1-262

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALVPCQVLRVAILLSYCSILCNYKAIEMPSHQTYGGSWKFLTFIDLVIQAVFFGICVLT DLSSLLTRGSGNQEQERQLRKLISLRDWTLAVLAFPVGVFVVAVFWTIYAYDREMIYPRL LDNFIPGWLNHGMHTTVLPFILIEMRTSHHQYPSRSSGLAAICTFSVGYILWVCWIHHVT GMWVYPFLEHIGSGARIIFFGSTTILMNFLYLLGEVLNSYIWDTQRTKAPSCQDTQSSLS CAKPVQNLCKDTFMLEGGKARA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-RPS6KA1 (Thr573) Rabbit Polyclonal Antibody (APC-Cy5.5)
orb1581268 100 µL

Phospho-RPS6KA1 (Thr573) Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
Recombinant Human Succinate receptor 1 (SUCNR1), partial
MBS7057194 Inquire

Recombinant Human Succinate receptor 1 (SUCNR1), partial

Sign In for Pricing
View Details
Tep1 ORF Vector (Rat) (pORF)
ORF077590 1.0 µg DNA

Tep1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
STT3B Rabbit pAb
A15574-01 1000 μL

STT3B Rabbit pAb

Sign In for Pricing
View Details
STT3B Rabbit pAb
A15574-02 20 µL

STT3B Rabbit pAb

Sign In for Pricing
View Details
STT3B Rabbit pAb
A15574-03 100 μL

STT3B Rabbit pAb

Sign In for Pricing
View Details