Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Androgen-induced gene 1 protein (Aig1)

This Recombinant Mouse Androgen-induced gene 1 protein (Aig1) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Androgen-induced gene 1 protein, AIG-1

UniProt

Q9D8B1

Expression Region

1-262

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALVPCQVLRVAILLSYCSILCNYKAIEMPSHQTYGGSWKFLTFIDLVIQAVFFGICVLT DLSSLLTRGSGNQEQERQLRKLISLRDWTLAVLAFPVGVFVVAVFWTIYAYDREMIYPRL LDNFIPGWLNHGMHTTVLPFILIEMRTSHHQYPSRSSGLAAICTFSVGYILWVCWIHHVT GMWVYPFLEHIGSGARIIFFGSTTILMNFLYLLGEVLNSYIWDTQRTKAPSCQDTQSSLS CAKPVQNLCKDTFMLEGGKARA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 7 Recombinant Rabbit mAb
BS47884-01 50 µL

Cytokeratin 7 Recombinant Rabbit mAb

Sign In for Pricing
View Details
Cytokeratin 7 Recombinant Rabbit mAb
BS47884-02 100 µL

Cytokeratin 7 Recombinant Rabbit mAb

Sign In for Pricing
View Details
OKCA01814-96W - IL7 ELISA Kit (Rabbit)
OKCA01814-96W 96 Well

OKCA01814-96W - IL7 ELISA Kit (Rabbit)

Sign In for Pricing
View Details
Bovine UPF0492 Protein C20orf94 (C20orf94) ELISA Kit
MBS2611088-01 48 Well

Bovine UPF0492 Protein C20orf94 (C20orf94) ELISA Kit

Sign In for Pricing
View Details
Bovine UPF0492 Protein C20orf94 (C20orf94) ELISA Kit
MBS2611088-02 96 Well

Bovine UPF0492 Protein C20orf94 (C20orf94) ELISA Kit

Sign In for Pricing
View Details
Bovine UPF0492 Protein C20orf94 (C20orf94) ELISA Kit
MBS2611088-03 5x 96 Well

Bovine UPF0492 Protein C20orf94 (C20orf94) ELISA Kit

Sign In for Pricing
View Details