Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Actinobacillus pleuropneumoniae serotype 5b ATP synthase subunit a (atpB)

This Recombinant Actinobacillus pleuropneumoniae serotype 5b ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A3N2V0

Expression Region

1-262

Origin

Actinobacillus pleuropneumoniae serotype 5b (strain L20)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGTTAEYISHHLSFLASGDGFWAVHLDTLFFSLLAGVIFLFVFSRVAKNATSGVPGKLQ CFVEIVIGWVDGLVKDNFHGPRNVIAPLALTIFCWVFIMNAIDLVPVDFLPQLANMFGIH YLRAVPTADISAPLGMSICVFFLILFYTVKSKGFGGLVKEYTLHPFNHWVFIPVNFILET VTLLAKPISLAFRLFGNMYAGELIFILIAVMYMADNFALQALGIPLHLVWAIFHILVITL QAFIFMMLTIVYLSIAYNKADH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 17 (E3), CF594 conjugate, 0.1mg/mL
BNC940158-100 1x 100 µL

Cytokeratin 17 (E3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF405S conjugate, 0.1mg/mL
BNC040164-500 1x 500 µL

CD28 (204.12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF647 conjugate, 0.1mg/mL
BNC470977-500 1x 500 µL

TGF-beta (1D11.16.8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL
BNC680043-500 1x 500 µL

P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (B22.1 + B23.1), CF594 conjugate, 0.1mg/mL
BNC941221-500 1x 500 µL

Cytokeratin 8/18 (B22.1 + B23.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD56 / NCAM (123C3.D5), CF488A conjugate, 0.1mg/mL
BNC880015-500 1x 500 µL

CD56 / NCAM (123C3.D5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details