Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nodulation protein J (nodJ)

This Recombinant Nodulation protein J (nodJ) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Nodulation protein J

UniProt

P24144

Expression Region

1-262

Origin

Rhizobium leguminosarum bv. trifolii

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGDSVTALPGGSLNWIAVWRRNYIAWKKAALASLLGHLAEPLIYLFGLGAGLGVMVGRV GGVSYTAFLAAGMVATSAMTAATFETIYAAFGRMEGQRTWEAMLYTQLRLGDIVLGEMAW AATKAALAGAGIGVVAAALGYTQWLSLLYALPVIALTGLAFASLGMVVTALAPSYDYFIF YQTLVITPILFLSGAVFPVDQLPIVFQTAARFLPLSHSIDLIRPIMLGHPVVDVCQHVGA LCIYIVIPFFLSTALLRRRLLR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal IGSF22 Antibody
NBP3-17595-25ul 25 µL

Rabbit Polyclonal IGSF22 Antibody

Sign In for Pricing
View Details
1'-Ethyl-1- (2-fluorophenyl) -1H,1'H-3,4'-bipyrazole-4-carbaldehyde
GQB32309-01 100 mg

1'-Ethyl-1- (2-fluorophenyl) -1H,1'H-3,4'-bipyrazole-4-carbaldehyde

Sign In for Pricing
View Details
1'-Ethyl-1- (2-fluorophenyl) -1H,1'H-3,4'-bipyrazole-4-carbaldehyde
GQB32309-02 1 g

1'-Ethyl-1- (2-fluorophenyl) -1H,1'H-3,4'-bipyrazole-4-carbaldehyde

Sign In for Pricing
View Details
Anti-IFNA4 Antibody (C-term)
A08980-1-80ul 80 µL

Anti-IFNA4 Antibody (C-term)

Sign In for Pricing
View Details
Rabbit Polyclonal mpp8 Antibody [CoraFluor 1]
NBP1-71809CL1 0.1 mL

Rabbit Polyclonal mpp8 Antibody [CoraFluor 1]

Sign In for Pricing
View Details
KCTD14 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A6]
TA502655AM 100 µL

KCTD14 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A6]

Sign In for Pricing
View Details