Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nodulation protein J (nodJ)

This Recombinant Nodulation protein J (nodJ) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Nodulation protein J

UniProt

P24144

Expression Region

1-262

Origin

Rhizobium leguminosarum bv. trifolii

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGDSVTALPGGSLNWIAVWRRNYIAWKKAALASLLGHLAEPLIYLFGLGAGLGVMVGRV GGVSYTAFLAAGMVATSAMTAATFETIYAAFGRMEGQRTWEAMLYTQLRLGDIVLGEMAW AATKAALAGAGIGVVAAALGYTQWLSLLYALPVIALTGLAFASLGMVVTALAPSYDYFIF YQTLVITPILFLSGAVFPVDQLPIVFQTAARFLPLSHSIDLIRPIMLGHPVVDVCQHVGA LCIYIVIPFFLSTALLRRRLLR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Filamin B/FLNB Antibody Picoband®, iFluor647 Conjugate
A02562-1-iFluor647 100 µg

Anti-Filamin B/FLNB Antibody Picoband®, iFluor647 Conjugate

Sign In for Pricing
View Details
pWPXLd-GAP43(WT) Plasmid
PVTB00704-4a 2 µg

pWPXLd-GAP43(WT) Plasmid

Sign In for Pricing
View Details
KIAA0196 polyclonal antibody
BS77963-01 50 µL

KIAA0196 polyclonal antibody

Sign In for Pricing
View Details
KIAA0196 polyclonal antibody
BS77963-02 100 µL

KIAA0196 polyclonal antibody

Sign In for Pricing
View Details
POT1 Antibody, FITC conjugated
A67782-100UG 100 µg

POT1 Antibody, FITC conjugated

Sign In for Pricing
View Details
Estrogen-Related Receptor, gamma (ERRg, NR3B3) discontinued. See E3565-22B
E3565-23A 50 µg

Estrogen-Related Receptor, gamma (ERRg, NR3B3) discontinued. See E3565-22B

Sign In for Pricing
View Details