Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nodulation protein J (nodJ)

This Recombinant Nodulation protein J (nodJ) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Nodulation protein J

UniProt

P24144

Expression Region

1-262

Origin

Rhizobium leguminosarum bv. trifolii

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGDSVTALPGGSLNWIAVWRRNYIAWKKAALASLLGHLAEPLIYLFGLGAGLGVMVGRV GGVSYTAFLAAGMVATSAMTAATFETIYAAFGRMEGQRTWEAMLYTQLRLGDIVLGEMAW AATKAALAGAGIGVVAAALGYTQWLSLLYALPVIALTGLAFASLGMVVTALAPSYDYFIF YQTLVITPILFLSGAVFPVDQLPIVFQTAARFLPLSHSIDLIRPIMLGHPVVDVCQHVGA LCIYIVIPFFLSTALLRRRLLR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-MTNR1A Polyclonal Antibody
TMAB-01177-01 50 μL

Anti-MTNR1A Polyclonal Antibody

Sign In for Pricing
View Details
Anti-MTNR1A Polyclonal Antibody
TMAB-01177-02 100 µL

Anti-MTNR1A Polyclonal Antibody

Sign In for Pricing
View Details
Anti-MTNR1A Polyclonal Antibody
TMAB-01177-03 200 µL

Anti-MTNR1A Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Jagged1/JAG1 Antibody Picoband® Fluoro488 Conjugated
A00640-2-Fluoro488 100 µg/Vial

Anti-Jagged1/JAG1 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
CDCA4 cDNA Clone
MBS1276484-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

CDCA4 cDNA Clone

Sign In for Pricing
View Details
CDCA4 cDNA Clone
MBS1276484-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

CDCA4 cDNA Clone

Sign In for Pricing
View Details