Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-X-C motif chemokine 13 protein (CXCL13), partial

Product Specifications

Product Name Alternative

AngieB cell-attracting chemokine 1 ; BCA-1B lymphocyte chemoattractantCXC chemokine BLCSmall-inducible cytokine B13

Abbreviation

Recombinant Human CXCL13 protein, partial

Gene Name

CXCL13

UniProt

O43927

Expression Region

23-95aa

Organism

Homo sapiens (Human)

Target Sequence

VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRS

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Relevance

Chotactic for B-lymphocytes but not for T-lymphocytes, monocytes and neutrophils. Does not induce calcium release in B-lymphocytes. Binds to BLR1/CXCR5.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Chemotactic for B-lymphocytes but not for T-lymphocytes, monocytes and neutrophils. Does not induce calcium release in B-lymphocytes. Binds to BLR1/CXCR5.

Molecular Weight

12.8 kDa

References & Citations

A B-cell-homing chemokine made in lymphoid follicles activates Burkitt's lymphoma receptor-1.Gunn M.D., Ngo V.N., Ansel K.M., Ekland E.H., Cyster J.G., Williams L.T.Nature 391:799-803 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP4K5 (NM_198794) Human Tagged ORF Clone Lentiviral Particle
RC205952L1V 200 µL

MAP4K5 (NM_198794) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Theileria parva Ubiquitin-fold modifier 1 (TP01_0287)
MBS1320935-01 0.02 mg (E-Coli)

Recombinant Theileria parva Ubiquitin-fold modifier 1 (TP01_0287)

Sign In for Pricing
View Details
Recombinant Theileria parva Ubiquitin-fold modifier 1 (TP01_0287)
MBS1320935-02 0.1 mg (E-Coli)

Recombinant Theileria parva Ubiquitin-fold modifier 1 (TP01_0287)

Sign In for Pricing
View Details
Recombinant Theileria parva Ubiquitin-fold modifier 1 (TP01_0287)
MBS1320935-03 0.02 mg (Yeast)

Recombinant Theileria parva Ubiquitin-fold modifier 1 (TP01_0287)

Sign In for Pricing
View Details
Recombinant Theileria parva Ubiquitin-fold modifier 1 (TP01_0287)
MBS1320935-04 0.1 mg (Yeast)

Recombinant Theileria parva Ubiquitin-fold modifier 1 (TP01_0287)

Sign In for Pricing
View Details
Recombinant Theileria parva Ubiquitin-fold modifier 1 (TP01_0287)
MBS1320935-05 0.02 mg (Baculovirus)

Recombinant Theileria parva Ubiquitin-fold modifier 1 (TP01_0287)

Sign In for Pricing
View Details