Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Post-GPI attachment to proteins factor 2 (tag-189)

This Recombinant Post-GPI attachment to proteins factor 2 (tag-189) spans the amino acid sequence from region 1-263.

Product Specifications

Product Name Alternative

Post-GPI attachment to proteins factor 2

UniProt

A8XST1

Expression Region

1-263

Origin

Caenorhabditis briggsae

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALGEDDILSVPFKYFVFCIGGLPSSALLICVLLSLFLHFDQATSTHCEVANWLPSISAA VSTYTPEKYIWRILIGLHIGPRLVVAVAFRNFLMSSPLRPYTGSKQFKFLCNIACGLNLL ENFFLLALTSISSSEDHSLHAKCFGGFAISSIIYMILSTWLFSESGRRRATNLGERSYEY KILGASIFVVCFFLGGYLYWRHNTYCEPGIYTLFALVEYSAVLSNIFFHCTLYYDFHGKN IALTSSFGSSHYNLLPTQIEKDT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIMM8B Antibody, Biotin conjugated
CSB-PA897567LD01HU-01 50 µg

TIMM8B Antibody, Biotin conjugated

Sign In for Pricing
View Details
TIMM8B Antibody, Biotin conjugated
CSB-PA897567LD01HU-02 100 µg

TIMM8B Antibody, Biotin conjugated

Sign In for Pricing
View Details
Anti-ESM1 Polyclonal Antibody 2
TMAB-05699-01 50 μL

Anti-ESM1 Polyclonal Antibody 2

Sign In for Pricing
View Details
Anti-ESM1 Polyclonal Antibody 2
TMAB-05699-02 100 µL

Anti-ESM1 Polyclonal Antibody 2

Sign In for Pricing
View Details
Anti-ESM1 Polyclonal Antibody 2
TMAB-05699-03 200 µL

Anti-ESM1 Polyclonal Antibody 2

Sign In for Pricing
View Details
Mouse ATP1B4 shRNA Plasmid
abx976336-01 150 µg

Mouse ATP1B4 shRNA Plasmid

Sign In for Pricing
View Details