Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Post-GPI attachment to proteins factor 2 (tag-189)

This Recombinant Post-GPI attachment to proteins factor 2 (tag-189) spans the amino acid sequence from region 1-263.

Product Specifications

Product Name Alternative

Post-GPI attachment to proteins factor 2

UniProt

A8XST1

Expression Region

1-263

Origin

Caenorhabditis briggsae

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALGEDDILSVPFKYFVFCIGGLPSSALLICVLLSLFLHFDQATSTHCEVANWLPSISAA VSTYTPEKYIWRILIGLHIGPRLVVAVAFRNFLMSSPLRPYTGSKQFKFLCNIACGLNLL ENFFLLALTSISSSEDHSLHAKCFGGFAISSIIYMILSTWLFSESGRRRATNLGERSYEY KILGASIFVVCFFLGGYLYWRHNTYCEPGIYTLFALVEYSAVLSNIFFHCTLYYDFHGKN IALTSSFGSSHYNLLPTQIEKDT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse S1P4/EDG-6 ELISA Kit (Colorimetric)
NBP2-82429 1 Kit

Mouse S1P4/EDG-6 ELISA Kit (Colorimetric)

Sign In for Pricing
View Details
ANO6 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
12045154 3x 1.0 µg DNA

ANO6 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
HBP1 (NM_012257) Human Tagged Lenti ORF Clone
RC202260L1 10 µg

HBP1 (NM_012257) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
BCL11A CRISPRa sgRNA lentivector (set of three targets)(Mouse)
13223124 3x 1.0µg DNA

BCL11A CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
alpha-SMA Polyclonal Antibody
MBS9245670-01 0.1 mL

alpha-SMA Polyclonal Antibody

Sign In for Pricing
View Details
alpha-SMA Polyclonal Antibody
MBS9245670-02 5x 0.1 mL

alpha-SMA Polyclonal Antibody

Sign In for Pricing
View Details