Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 56 (TMEM56)

This Recombinant Human Transmembrane protein 56 (TMEM56) spans the amino acid sequence from region 1-263.

Product Specifications

Product Name Alternative

Transmembrane protein 56

UniProt

Q96MV1

Expression Region

1-263

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEINTKLLISVTCISFFTFQLLFYFVSYWFSAKVSPGFNSLSFKKKIEWNSRVVSTCHSL VVGIFGLYIFLFDEATKADPLWGGPSLANVNIAIASGYLISDLSIIILYWKVIGDKFFIM HHCASLYAYYLVLKNGVLAYIGNFRLLAELSSPFVNQRWFFEALKYPKFSKAIVINGILM TVVFFIVRIASMLPHYGFMYSVYGTEPYIRLGVLIQLSWVISCVVLDVMNVMWMIKISKG CIKVISHIRQEKAKNSLQNGKLD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HCV NS5 genotype 3a 36 kDa
PR-1418-L 1 mg

HCV NS5 genotype 3a 36 kDa

Sign In for Pricing
View Details
TGIF1 Rabbit Polyclonal Antibody
orb581358 100 µL

TGIF1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal CHREBP Antibody [Biotin]
NB400-136B 0.1 mL

Rabbit Polyclonal CHREBP Antibody [Biotin]

Sign In for Pricing
View Details
DKKL1 Protein Vector (Rat) (pPB-C-His)
PV264166 500 ng

DKKL1 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Goat anti-FOXD1 / FREAC4 / FKHL8 Antibody
dAP-0227 50 µg

Goat anti-FOXD1 / FREAC4 / FKHL8 Antibody

Sign In for Pricing
View Details
EAN57 Rabbit Polyclonal Antibody (Cy3)
orb985524 100 µL

EAN57 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details