Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Post-GPI attachment to proteins factor 2 (tag-189)

This Recombinant Post-GPI attachment to proteins factor 2 (tag-189) spans the amino acid sequence from region 1-263.

Product Specifications

Product Name Alternative

Post-GPI attachment to proteins factor 2

UniProt

Q22141

Expression Region

1-263

Origin

Caenorhabditis elegans

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFGDDDILSIPFKYFVICIGGLPSSALLICVILSLLLHFDQATSTHCEVANWLPSISAA VSTYTPEKYIWRILIGLHIGPRLVVAIAFRNFLLGSPLRPLTGHKRLRFLCNLACFLNLL ENFFLLALTSISSSEDHSLHAKCFGGFAICSIIYMLLSTWLFNETGRRTATNLGQRSHEY KILGAAIFVLCFFLGAYLYWRHNTYCEPGIYTLFALVEYSAVLSNIFFHCTLYYDFHGKN IVLTSSFGGGHYNLLPTQIDKDT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human EEF1AKMT1 sgRNA gene knockout kit - Lentiviral human EEF1AKMT1 sgRNA gene knockout kit (plasmid)
GTR15367532 1 Vial

Lentiviral human EEF1AKMT1 sgRNA gene knockout kit - Lentiviral human EEF1AKMT1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
GOLPH2 (GOLM1) (NM_016548) Human Mass Spec Standard
PH314745 10 µg

GOLPH2 (GOLM1) (NM_016548) Human Mass Spec Standard

Sign In for Pricing
View Details
CBWD2 sgRNA CRISPR Lentivector (Human) (Target 2)
K0369903 1.0 µg DNA

CBWD2 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Stathmin 1 (Phospho-Ser25) Polyclonal Conjugated Antibody
orb1630999 100 µL

Stathmin 1 (Phospho-Ser25) Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Recombinant Ustilago maydis GPN-loop GTPase 3 homolog UM01243 (UM01243)
MBS1436575-01 0.02 mg (E-Coli)

Recombinant Ustilago maydis GPN-loop GTPase 3 homolog UM01243 (UM01243)

Sign In for Pricing
View Details
Recombinant Ustilago maydis GPN-loop GTPase 3 homolog UM01243 (UM01243)
MBS1436575-02 0.02 mg (Yeast)

Recombinant Ustilago maydis GPN-loop GTPase 3 homolog UM01243 (UM01243)

Sign In for Pricing
View Details