Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Post-GPI attachment to proteins factor 2 (tag-189)

This Recombinant Post-GPI attachment to proteins factor 2 (tag-189) spans the amino acid sequence from region 1-263.

Product Specifications

Product Name Alternative

Post-GPI attachment to proteins factor 2

UniProt

Q22141

Expression Region

1-263

Origin

Caenorhabditis elegans

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFGDDDILSIPFKYFVICIGGLPSSALLICVILSLLLHFDQATSTHCEVANWLPSISAA VSTYTPEKYIWRILIGLHIGPRLVVAIAFRNFLLGSPLRPLTGHKRLRFLCNLACFLNLL ENFFLLALTSISSSEDHSLHAKCFGGFAICSIIYMLLSTWLFNETGRRTATNLGQRSHEY KILGAAIFVLCFFLGAYLYWRHNTYCEPGIYTLFALVEYSAVLSNIFFHCTLYYDFHGKN IVLTSSFGGGHYNLLPTQIDKDT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRNAN20 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2508408 1.0 µg DNA

TRNAN20 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Human Keratin 18 ELISA Kit
MBS060249-01 48 Well

Human Keratin 18 ELISA Kit

Sign In for Pricing
View Details
Human Keratin 18 ELISA Kit
MBS060249-02 96 Well

Human Keratin 18 ELISA Kit

Sign In for Pricing
View Details
Human Keratin 18 ELISA Kit
MBS060249-03 5x 96 Well

Human Keratin 18 ELISA Kit

Sign In for Pricing
View Details
Human Keratin 18 ELISA Kit
MBS060249-04 10x 96 Well

Human Keratin 18 ELISA Kit

Sign In for Pricing
View Details
2-bromo-5- (isopropylthio) thiophene
OR1088587-01 250 mg

2-bromo-5- (isopropylthio) thiophene

Sign In for Pricing
View Details