Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pelobacter carbinolicus Undecaprenyl-diphosphatase (uppP)

This Recombinant Pelobacter carbinolicus Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-263.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

Q3A6V2

Expression Region

1-263

Origin

Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFLHAILLGLLQGLTEFLPVSSSGHLAIAQHFLPGFSQPGVLFDVLLHAGTMAAVLVYF RYDCRHLALAYFRPHEEAHQYRRLLRLLIIATVPTAIIGLSFKDFFVGAFHNLPLISLML VVTGGLLFFSERLRKNGRSQGHLQHWDALIAGVAQAGAIMPGISRSGSTISVLLFKGVSG ETAARFSFLMALPAVFGATLVSLLEWPAGVSAEIPVYAAGAVMAFLSGLASIHLLMGVVR RRRLYAFAVYCWLMGGMFFAISS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP27 (G3.1), CF647 conjugate, 0.1mg/mL
BNC470861-100 1x 100 µL

HSP27 (G3.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF568 conjugate, 0.1mg/mL
BNC681429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF488A conjugate, 0.1mg/mL
BNC880871-500 1x 500 µL

CD71 (66IG10), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (rKRT8.18/1346), CF647 conjugate, 0.1mg/mL
BNC472298-500 1x 500 µL

Cytokeratin 8/18 (rKRT8.18/1346), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rCD30/412), CF640R conjugate, 0.1mg/mL
BNC401919-100 1x 100 µL

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rCD30/412), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MiTF (Microphthalmia Transcription Factor) (C5/D5), CF640R conjugate, 0.1mg/mL
BNC400892-500 1x 500 µL

MiTF (Microphthalmia Transcription Factor) (C5/D5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details