Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus thermophilus Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Streptococcus thermophilus Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-263.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

Q5M0J6

Expression Region

1-263

Origin

Streptococcus thermophilus (strain CNRZ 1066)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLATIDPIALRLGPISIHWYAICIVSGLLLAVYLAQRLAPEKGINPEHILDFILLAFPIA IVGARLYYVIFQWSYYSQNPSEIFAIWNGGIAIYGGLIAGAAVLYWFAKRHAIAVLDFLD IAAPGVMIAQSIGRWGNFVNQEAYGKAVSQLNYLPEIIRQQMFINGSYRVPTFLYESLWN LVGFSIILGLRYFNKGLRQGDVTSFYLIWYGLGRFVIEGMRTDSLMFVGLRVSQWVSISI IILGAVLLYFRKQRQKADYKMKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P27 / KIP1 (SX53G8), CF640R conjugate, 0.1mg/mL
BNC400669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL
BNC880026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF594 conjugate, 0.1mg/mL
BNC940352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXA1 / HNF3A (FOXA1/2230R), CF568 conjugate, 0.1mg/mL
BNC682230-100 1x 100 µL

FOXA1 / HNF3A (FOXA1/2230R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Glycophorin A / CD235a (GYPA/280), CF568 conjugate, 0.1mg/mL
BNC680280-100 1x 100 µL

Glycophorin A / CD235a (GYPA/280), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (DE-K18), CF647 conjugate, 0.1mg/mL
BNC470563-100 1x 100 µL

Cytokeratin 18 (DE-K18), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details