Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhomboid-like protease 3 (ROM3)

This Recombinant Rhomboid-like protease 3 (ROM3) spans the amino acid sequence from region 1-263.

Product Specifications

Product Name Alternative

Rhomboid-like protease 3, EC= 3.4.21.105

UniProt

Q6IUY1

Expression Region

1-263

Origin

Toxoplasma gondii

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASSDGSDVETQSLLNSGDRTLRSWKDTVFPGISWDKSIVWITVAQIIMYIISCVLSRSY EPNERTLMLLGAAYAPAFSNFQLWRVVTPLFLHATILHLVLNLVFILHISLRLEERYGTK KFLVTYFLSAIVGNLLSMLMQPWALSVGASTAGFGIIGGMAAEVSVVWCKLSEELKRIYS MDICILAVLIYFLSFGRTVDTFGHLGGFLAGVALVCYYNKEIEDLPKWFRVLFYGCSALC ATILVVSPPLLLLRYPYRVAATS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Argonaute 2 Recombinant Rabbit monoclonal Antibody [JF0992]
ET1702-39-50UL 50 µL

Argonaute 2 Recombinant Rabbit monoclonal Antibody [JF0992]

Sign In for Pricing
View Details
GLI2 Antibody (Biotin)
KB-8161-01 50 μL

GLI2 Antibody (Biotin)

Sign In for Pricing
View Details
GLI2 Antibody (Biotin)
KB-8161-02 100 µL

GLI2 Antibody (Biotin)

Sign In for Pricing
View Details
GLI2 Antibody (Biotin)
KB-8161-03 1 mL

GLI2 Antibody (Biotin)

Sign In for Pricing
View Details
trFluor™ Tb goat anti-mouse IgG (H+L) *Cross Adsorbed*
16599-AAT 100 µg

trFluor™ Tb goat anti-mouse IgG (H+L) *Cross Adsorbed*

Sign In for Pricing
View Details
Anti-AURKAIP1 mouse | Aurora kinase A-interacting protein
AS22 4718 50 µg

Anti-AURKAIP1 mouse | Aurora kinase A-interacting protein

Sign In for Pricing
View Details