Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lens fiber major intrinsic protein (Mip)

This Recombinant Mouse Lens fiber major intrinsic protein (Mip) spans the amino acid sequence from region 1-263.

Product Specifications

Product Name Alternative

Lens fiber major intrinsic protein, Aquaporin-0, MIP26, MP26

UniProt

P51180

Expression Region

1-263

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWELRSASFWRAIFAEFFATLFYVFFGLGASLRWAPGPLHVLQVALAFGLALATLVQTVG HISGAHVNPAVTFAFLVGSQMSLLRAFCYIAAQLLGAVAGAAVLYSVTPPAVRGNLALNT LHAGVSVGQATTVEIFLTLQFVLCIFATYDERRNGRMGSVALAVGFSLTLGHLFGMYYTG AGMNPARSFAPAILTRNFSNHWVYWVGPIIGGGLGSLLYDFLLFPRLKSVSERLSILKGA RPSDSNGQPEGTGEPVELKTQAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (RIV11), CF594 conjugate, 0.1mg/mL
BNC940333-500 1x 500 µL

CD8 (RIV11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF568 conjugate, 0.1mg/mL
BNC680994-100 1x 100 µL

TNF alpha (J2D10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RB (B-Cell Marker) (PTPRC/1783R), CF594 conjugate, 0.1mg/mL
BNC941783-100 1x 100 µL

CD45RB (B-Cell Marker) (PTPRC/1783R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRAcP (Tartarate Resistant Acid Phosphatase) (ACP5/1070), CF488A conjugate, 0.1mg/mL
BNC881070-100 1x 100 µL

TRAcP (Tartarate Resistant Acid Phosphatase) (ACP5/1070), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL1 + T200/797), CF594 conjugate, 0.1mg/mL
BNC941209-500 1x 500 µL

CD45RO (UCHL1 + T200/797), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bax (BAX/962), CF640R conjugate, 0.1mg/mL
BNC400962-500 1x 500 µL

Bax (BAX/962), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details