Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pasteurella multocida ATP synthase subunit a (atpB)

This Recombinant Pasteurella multocida ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-264.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q9CKW6

Expression Region

1-264

Origin

Pasteurella multocida (strain Pm70)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAELTTAGYIGHHLAFLKTGDSFWHVHLDTLLFSIISGAIFLFVFSKVAKKATPGVPSK MQCFVEIMVDWIDGIVKENFHGPRHAVGPLALTIFCWVFIMNAIDLIPVDFLPQLAHLFG IEYLRAVPTADISGTLGLSIGVFFLIIFYTIKSKGMSGFVKEYTLHPFNHPLLIPVNLAL ESVTLLAKPVSLAFRLFGNMYAGELIFILIAVMYMANNFALNSMGIFMHLAWAIFHILVI TLQAFIFMMLTVVYLSMGYNKAEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Influenza B, Hemagglutinin (AP) discontinued
I7651-42C-AP 100 µL

Influenza B, Hemagglutinin (AP) discontinued

Sign In for Pricing
View Details
Recombinant Human TPO, N-His
ARO-P13723-01 50 µg

Recombinant Human TPO, N-His

Sign In for Pricing
View Details
Recombinant Human TPO, N-His
ARO-P13723-02 100 µg

Recombinant Human TPO, N-His

Sign In for Pricing
View Details
Recombinant Human TPO, N-His
ARO-P13723-03 1 mg

Recombinant Human TPO, N-His

Sign In for Pricing
View Details
RRAGC Rabbit Polyclonal Antibody (Cy3)
orb986727 100 µL

RRAGC Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Calpain 12 Polyclonal Antibody
MBS2539168-01 0.02 mL

Calpain 12 Polyclonal Antibody

Sign In for Pricing
View Details