Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human TLC domain-containing protein 2 (TLCD2)

This Recombinant Human TLC domain-containing protein 2 (TLCD2) spans the amino acid sequence from region 1-264.

Product Specifications

Product Name Alternative

TLC domain-containing protein 2

UniProt

A6NGC4

Expression Region

1-264

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPTGLLVAGASFLAFRGLHWGLRRLPTPESAARDRWQWWNLCVSLAHSLLSGTGALLGL SLYPQMAADPIHGHPRWALVLVAVSVGYFLADGADLLWNQTLGKTWDLLCHHLVVVSCLS TAVLSGHYVGFSMVSLLLELNSACLHLRKLLLLSRQAPSLAFSVTSWASLATLALFRLVP LGWMSLWLFRQHHQVPLALVTLGGIGLVTVGIMSIILGIRILVNDVLQSRPHPPSPGHEK TRGTRTRRDNGPVTSNSSTLSLKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIAA1324L AAV Vector (Human) (CMV)
25604101 1 µg

KIAA1324L AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
PAQR6 CRISPR All-in-one AAV vector set (with saCas9)(Human)
36002151 3x 1.0 µg DNA

PAQR6 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Rabbit Polyclonal Histone H3 [ac Lys18] Antibody [Alexa Fluor 647]
NB21-1144AF647 0.05 mL

Rabbit Polyclonal Histone H3 [ac Lys18] Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
Hsa-miR-196a-3p miRNA Mimic
orb1878237-01 5 nmol

Hsa-miR-196a-3p miRNA Mimic

Sign In for Pricing
View Details
Hsa-miR-196a-3p miRNA Mimic
orb1878237-02 10 nmol

Hsa-miR-196a-3p miRNA Mimic

Sign In for Pricing
View Details
Dystrophin Antibody, mAb, Rabbit
A03496-100 100 µL

Dystrophin Antibody, mAb, Rabbit

Sign In for Pricing
View Details