Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella amazonensis ATP synthase subunit a (atpB)

This Recombinant Shewanella amazonensis ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-264.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A1SBU6

Expression Region

1-264

Origin

Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAATGEALTPQGYIQHHLTNLSVGEGFWTWHIDSLLFSVGLGVLFLWIFRSVGKKATTGV PGKLQCFVEMIVEFVDNSVKETFHGRNALIAPLALTIFVWVFMMNFMDMVPVDWLPHTAA MLGVPYLKVVPTTDLNITFSLALGVFLLIIYYSIKVKGVSGFVKELTLQPFNHWAMIPVN LLLESVTLIAKPISLALRLFGNLYAGELIFILIALMYGANWLIASLGVTLQLGWLIFHIL VITLQAFIFMMLTIVYLSMAHEDH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHF21A (NM_001101802) Human Tagged ORF Clone Lentiviral Particle
RC213929L4V 200 µL

PHF21A (NM_001101802) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
cis-Vaccenic acid-D13
MBS3920052 Inquire

cis-Vaccenic acid-D13

Sign In for Pricing
View Details
Waterproof CRYO-GRIP® GLOVE Wrist
1464358 1 Unit

Waterproof CRYO-GRIP® GLOVE Wrist

Sign In for Pricing
View Details
TCEA1 Antibody (Center) Blocking Peptide
MBS9221077-01 0.5 mg

TCEA1 Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
TCEA1 Antibody (Center) Blocking Peptide
MBS9221077-02 5x 0.5 mg

TCEA1 Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
SWAB SOLUTION SURFACES  5 ml (Culture media in glass tubes/bottles)
20160 20 Tubes

SWAB SOLUTION SURFACES 5 ml (Culture media in glass tubes/bottles)

Sign In for Pricing
View Details