Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella amazonensis ATP synthase subunit a (atpB)

This Recombinant Shewanella amazonensis ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-264.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A1SBU6

Expression Region

1-264

Origin

Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAATGEALTPQGYIQHHLTNLSVGEGFWTWHIDSLLFSVGLGVLFLWIFRSVGKKATTGV PGKLQCFVEMIVEFVDNSVKETFHGRNALIAPLALTIFVWVFMMNFMDMVPVDWLPHTAA MLGVPYLKVVPTTDLNITFSLALGVFLLIIYYSIKVKGVSGFVKELTLQPFNHWAMIPVN LLLESVTLIAKPISLALRLFGNLYAGELIFILIALMYGANWLIASLGVTLQLGWLIFHIL VITLQAFIFMMLTIVYLSMAHEDH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM131A Antibody - C-terminal region : FITC (ARP70316_P050-FITC)
ARP70316_P050-FITC 100 µL

FAM131A Antibody - C-terminal region : FITC (ARP70316_P050-FITC)

Sign In for Pricing
View Details
Cip4 (TRIP10) Human Over-expression Lysate
orb1366271 20 µg

Cip4 (TRIP10) Human Over-expression Lysate

Sign In for Pricing
View Details
[1,1'-Biphenyl]-4-yl (methyl) sulfane
OR1086764 1 Each

[1,1'-Biphenyl]-4-yl (methyl) sulfane

Sign In for Pricing
View Details
Anti-CD14 antibody
PAab01426 100 µg

Anti-CD14 antibody

Sign In for Pricing
View Details
Recombinant human CCL18/MIP-4 protein
ATGP0853-010 10 µg

Recombinant human CCL18/MIP-4 protein

Sign In for Pricing
View Details
N-acylethanolamine-hydrolyzing acid amidase
orb1639029-01 50 µg

N-acylethanolamine-hydrolyzing acid amidase

Sign In for Pricing
View Details