Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella amazonensis ATP synthase subunit a (atpB)

This Recombinant Shewanella amazonensis ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-264.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A1SBU6

Expression Region

1-264

Origin

Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAATGEALTPQGYIQHHLTNLSVGEGFWTWHIDSLLFSVGLGVLFLWIFRSVGKKATTGV PGKLQCFVEMIVEFVDNSVKETFHGRNALIAPLALTIFVWVFMMNFMDMVPVDWLPHTAA MLGVPYLKVVPTTDLNITFSLALGVFLLIIYYSIKVKGVSGFVKELTLQPFNHWAMIPVN LLLESVTLIAKPISLALRLFGNLYAGELIFILIALMYGANWLIASLGVTLQLGWLIFHIL VITLQAFIFMMLTIVYLSMAHEDH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAF4B Human qPCR Primer Pair (NM_005640)
HP208743 200 Reactions

TAF4B Human qPCR Primer Pair (NM_005640)

Sign In for Pricing
View Details
CCDC122 (NM_144974) Human Over-expression Lysate
LS160857-100ug 100 µg

CCDC122 (NM_144974) Human Over-expression Lysate

Sign In for Pricing
View Details
NXNL1 sgRNA CRISPR Lentivector (Human) (Target 2)
K1471403 1.0 µg DNA

NXNL1 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Purified Anti-Human CD206 Antibody[15-2]
E-AB-F1161A-01 25 µg

Purified Anti-Human CD206 Antibody[15-2]

Sign In for Pricing
View Details
Purified Anti-Human CD206 Antibody[15-2]
E-AB-F1161A-02 100 µg

Purified Anti-Human CD206 Antibody[15-2]

Sign In for Pricing
View Details
Adenosine A2a Receptor Antibody
MBS9233156-01 0.1 mL

Adenosine A2a Receptor Antibody

Sign In for Pricing
View Details