Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycoplasma pneumoniae Uncharacterized protein MPN_096 (MPN_096)

This Recombinant Mycoplasma pneumoniae Uncharacterized protein MPN_096 (MPN_096) spans the amino acid sequence from region 1-264.

Product Specifications

Product Name Alternative

Uncharacterized protein MPN_096

UniProt

P75596

Expression Region

1-264

Origin

Mycoplasma pneumoniae (strain ATCC 29342 / M129)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLLGLGIVVLIYSLIALSVSLTTPNGAFSGLGDWLKHKKLGWFFGVLNLLIALGVAGIIN GFVMWTGKLTQSLIKSGELWVPDKCKLCLNKPKPVVGLIHAGILMVLTTVALSSLGGLLY LPKVNASYDGKGFKSMGCLLEFADLIATWTSVGIFWFLGLVLLGGLLQIKKPKRWYFRTT GWLAVVVIGLTTLVVMVQPFVDLGIAVFNRSYERIVANTILIAILVIIVLVMFFPTEPIK LRLWRKRIQAMEACGEDCDACVEY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 (PAb122), CF640R conjugate, 0.1mg/mL
BNC400338-100 1x 100 µL

P53 (PAb122), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL
BNC880158-500 1x 500 µL

Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF594 conjugate, 0.1mg/mL
BNC940189-500 1x 500 µL

CD74 (BU45), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL
BNC681820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF647 conjugate, 0.1mg/mL
BNC470008-100 1x 100 µL

MAGE A1 (MA454), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF740 conjugate, 0.1mg/mL
BNC740151-100 1x 100 µL

CD11a (Cris-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details