Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella choleraesuis Putative 2-aminoethylphosphonate transport system permease protein phnV (phnV)

This Recombinant Salmonella choleraesuis Putative 2-aminoethylphosphonate transport system permease protein phnV (phnV) spans the amino acid sequence from region 1-265.

Product Specifications

Product Name Alternative

Putative 2-aminoethylphosphonate transport system permease protein phnV

UniProt

Q57SD8

Expression Region

1-265

Origin

Salmonella choleraesuis (strain SC-B67)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPIWSPKGRAAAGVVASVLFIVFFFLPLAVILMSSLSQQWNGILPSGFTLNHFVNALHGA AWDALLASLTIGFCASLFALLCGVWAALALRQYGVKTQKWLSMVFYLPSAIPSVSVGLGI LVAFSQGPLQMNGTLWIVLTAHFVLISAFTFSNVSTGLARISADIENVASSLGASPWYRL RHVTLPLLMPWMMSALALSLSLSMGELGATMMIYPPGWTTLPVAIFSLTDRGNIADGAAL TIVLVAITLLLMMKLERIAKWLGQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP27 (G3.1), CF647 conjugate, 0.1mg/mL
BNC470861-500 1x 500 µL

HSP27 (G3.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF640R conjugate, 0.1mg/mL
BNC400266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (QBEnd/10), CF488A conjugate, 0.1mg/mL
BNC880640-500 1x 500 µL

CD34 (QBEnd/10), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Alkaline Phosphatase (ALPL/597), CF488A conjugate, 0.1mg/mL
BNC880597-500 1x 500 µL

Alkaline Phosphatase (ALPL/597), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HER-2 / CD340 (HRB2/718), CF647 conjugate, 0.1mg/mL
BNC470718-500 1x 500 µL

HER-2 / CD340 (HRB2/718), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1527), CF640R conjugate, 0.1mg/mL
BNC401950-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1527), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details