Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi A Putative 2-aminoethylphosphonate transport system permease protein phnV (phnV)

This Recombinant Salmonella paratyphi A Putative 2-aminoethylphosphonate transport system permease protein phnV (phnV) spans the amino acid sequence from region 1-265.

Product Specifications

Product Name Alternative

Putative 2-aminoethylphosphonate transport system permease protein phnV

UniProt

Q5PFQ5

Expression Region

1-265

Origin

Salmonella paratyphi A (strain ATCC 9150 / SARB42)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLIWSPKGRAAAGVVASVLFIVFFFLPLAVILMSSLSQQWNGILPSGFTLNHFVNALHGA AWDALLASLTIGFCASLFALLCGVWAALALRQYGVKTQKWLSMVFYLPSAIPSVSVGLGI LVAFSQGPLQMNGTLWIVLTAHFVLISAFTFSNVSTGLARISADIENVASSLGASPWYRL RHVTLPLLMPWMVSALALSLSLSMGELGATVMIYPPGWTTLPVAIFSLTDRGNIADGAAL TIVLVAITLLLMMKLERIAKRLGQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LIM domain only 3 (LMO3) (NM_001001395) Human Tagged ORF Clone Lentiviral Particle
RC213789L2V 200 µL

LIM domain only 3 (LMO3) (NM_001001395) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
3-Bromo-4-oxo-piperidine-1-carboxylic acid tert-butyl ester
sc-283688 250 mg

3-Bromo-4-oxo-piperidine-1-carboxylic acid tert-butyl ester

Sign In for Pricing
View Details
P4HB Polyclonal Antibody
A52628-050 50 µL

P4HB Polyclonal Antibody

Sign In for Pricing
View Details
CCK-8 (Cholecystokinin 8) BioAssayTM ELISA Kit (Rat) discontinued
354551-01 48 Tests

CCK-8 (Cholecystokinin 8) BioAssayTM ELISA Kit (Rat) discontinued

Sign In for Pricing
View Details
CCK-8 (Cholecystokinin 8) BioAssayTM ELISA Kit (Rat) discontinued
354551-02 96 Tests

CCK-8 (Cholecystokinin 8) BioAssayTM ELISA Kit (Rat) discontinued

Sign In for Pricing
View Details
Human TMEM126B shRNA Plasmid
abx960980-01 150 µg

Human TMEM126B shRNA Plasmid

Sign In for Pricing
View Details