Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Aquaporin-5 (Aqp5)

This Recombinant Mouse Aquaporin-5 (Aqp5) spans the amino acid sequence from region 1-265.

Product Specifications

Product Name Alternative

Aquaporin-5, AQP-5

UniProt

Q9WTY4

Expression Region

1-265

Origin

Mus musculus (Mouse)

Field of Research

Kidney & Urological Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKEVCSVAFFKAVFAEFLATLIFVFFGLGSALKWPSALPTILQISIAFGLAIGTLAQAL GPVSGGHINPAITLALLIGNQISLLRAIFYVAAQLVGAIAGAGILYWLAPGNARGNLAVN ALSNNTTPGKAVVVELILTFQLALCIFSSTDSRRTSPVGSPALSIGLSVTLGHLVGIYFT GCSMNPARSFGPAVVMNRFSPSHWVFWVGPIVGAVLAAILYFYLLFPSSLSLHDRVAVVK GTYEPEEDWEDHREERKKTIELTAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD95 (B-R18), CF568 conjugate, 0.1mg/mL
BNC680305-100 1x 100 µL

CD95 (B-R18), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL
BNC550525-500 1x 500 µL

CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF488A conjugate, 0.1mg/mL
BNC880460-100 1x 100 µL

CD44 Standard (156-3C11), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF740 conjugate, 0.1mg/mL
BNC740257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thymidylate Synthase (TS106), CF640R conjugate, 0.1mg/mL
BNC400714-100 1x 100 µL

Thymidylate Synthase (TS106), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1389), CF594 conjugate, 0.1mg/mL
BNC941389-100 1x 100 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1389), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details