Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Aquaporin-5 (Aqp5)

This Recombinant Rat Aquaporin-5 (Aqp5) spans the amino acid sequence from region 1-265.

Product Specifications

Product Name Alternative

Aquaporin-5, AQP-5

UniProt

P47864

Expression Region

1-265

Origin

Rattus norvegicus (Rat)

Field of Research

Kidney & Urological Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKEVCSLAFFKAVFAEFLATLIFVFFGLGSALKWPSALPTILQISIAFGLAIGTLAQAL GPVSGGHINPAITLALLIGNQISLLRAVFYVAAQLVGAIAGAGILYWLAPLNARGNLAVN ALNNNTTPGKAMVVELILTFQLALCIFSSTDSRRTSPVGSPALSIGLSVTLGHLVGIYFT GCSMNPARSFGPAVVMNRFSPSHWVFWVGPIVGAMLAAILYFYLLFPSSLSLHDRVAVVK GTYEPEEDWEDHREERKKTIELTAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11c (HC1/1), CF680R conjugate, 0.1mg/mL
BNC810152-500 1x 500 µL

CD11c (HC1/1), CF680R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF594 conjugate, 0.1mg/mL
BNC941045-500 1x 500 µL

CD16 (C16/1045), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL
BNC740029-100 1x 100 µL

Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL
BNC400026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF405S conjugate, 0.1mg/mL
BNC040266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-x (2H12), CF594 conjugate, 0.1mg/mL
BNC940751-500 1x 500 µL

Bcl-x (2H12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details