Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

This Recombinant Bacillus subtilis Energy-coupling factor transporter transmembrane protein EcfT (ecfT) spans the amino acid sequence from region 1-265.

Product Specifications

Product Name Alternative

Energy-coupling factor transporter transmembrane protein EcfT, ECF transporter T component EcfT

UniProt

P70972

Expression Region

1-265

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMDSMIIGKYVPGTSLVHRLDPRTKLITIFLFVCIVFLANNVQTYALLGLFTIGVVSLTR VPFSFLMKGLKPIIWIVLFTFLLHILMTHEGPIIFQIGFFKVYEGGLVQGIFISLRFVYL ILITTLLTLTTTPIEITDGMEQLLNPLKKLKLPVHELALMMSISLRFIPTLMEETDKIMK AQMARGVDFTSGPVKERVKAIVPLLVPLFVSAFKRAEELAVAMEARGYQGGEGRTKYRKL VWTGKDTSVIVSLIVLAALLFFLRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAST Avian Sexing PCR kit
MBK0102 48 TEST

FAST Avian Sexing PCR kit

Sign In for Pricing
View Details
MCM4 (Minichromosome Maintenance Deficient 4, CDC21, CDC21 Homolog, CDC54, DNA Replication Licensing Factor MCM4, hCdc21, Homolog of S. pombe Cell Devision Cycle 21, MGC33310, Minichromosome Maintenance 4, Minichromosome Maintenance Complex Component 4, P1-CDC21) (Biotin)
129498-Biotin 100 µL

MCM4 (Minichromosome Maintenance Deficient 4, CDC21, CDC21 Homolog, CDC54, DNA Replication Licensing Factor MCM4, hCdc21, Homolog of S. pombe Cell Devision Cycle 21, MGC33310, Minichromosome Maintenance 4, Minichromosome Maintenance Complex Component 4, P1-CDC21) (Biotin)

Sign In for Pricing
View Details
RXRA (Retinoic Acid Receptor RXR-alpha, Retinoid X Receptor, Alpha)
491092 100 µL

RXRA (Retinoic Acid Receptor RXR-alpha, Retinoid X Receptor, Alpha)

Sign In for Pricing
View Details
C9orf103 Polyclonal Antibody
bs-15308R 100 µL

C9orf103 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Rat Speckle targeted PIP5K1A-regulated poly (A) polymerase (Tut1) , partial
MBS1435882 Inquire

Recombinant Rat Speckle targeted PIP5K1A-regulated poly (A) polymerase (Tut1) , partial

Sign In for Pricing
View Details
Rabbit Polyclonal WWOX Antibody [mFluor Violet 610 SE]
NBP2-97814MFV610 0.1 mL

Rabbit Polyclonal WWOX Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details