Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Capsule polysaccharide export inner-membrane protein BexB (bexB)

This Recombinant Capsule polysaccharide export inner-membrane protein BexB (bexB) spans the amino acid sequence from region 1-265.

Product Specifications

Product Name Alternative

Capsule polysaccharide export inner-membrane protein BexB

UniProt

P19390

Expression Region

1-265

Origin

Haemophilus influenzae

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQYGDKTTFKQSLAIQGRVINALLMREIITRYGRQNIGFFWLFVEPLLMTFFIVMMWKFI RADKFSTLNMIAFVMTGYPMAMMWRNASNRAIGSISANLSLLYHRNVRVLDTIFTRVLLE VAGASIAQILFMAILVMIDWIDAPHDVFYMLIAWFLMAMFAFGLGLIICAIAQQFDVFGK IWGTLSFVLLPISGAFFFVHNLPAQAQSIALWFPMIHGTEMFRHGYFGDTVVTYESIGFL VVSDLALLLLGLVMVKNFSKGVEPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABCG8 Rabbit Polyclonal Antibody (BF350)
orb2554436 100 µL

ABCG8 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
Recombinant Ashbya gossypii FK506-binding protein 3 (FPR3)
MBS1448732-01 0.05 mg (E-Coli)

Recombinant Ashbya gossypii FK506-binding protein 3 (FPR3)

Sign In for Pricing
View Details
Recombinant Ashbya gossypii FK506-binding protein 3 (FPR3)
MBS1448732-02 0.05 mg (Yeast)

Recombinant Ashbya gossypii FK506-binding protein 3 (FPR3)

Sign In for Pricing
View Details
Recombinant Ashbya gossypii FK506-binding protein 3 (FPR3)
MBS1448732-03 0.05 mg (Baculovirus)

Recombinant Ashbya gossypii FK506-binding protein 3 (FPR3)

Sign In for Pricing
View Details
Recombinant Ashbya gossypii FK506-binding protein 3 (FPR3)
MBS1448732-04 0.2 mg (E-Coli)

Recombinant Ashbya gossypii FK506-binding protein 3 (FPR3)

Sign In for Pricing
View Details
Recombinant Ashbya gossypii FK506-binding protein 3 (FPR3)
MBS1448732-05 0.5 mg (E-Coli)

Recombinant Ashbya gossypii FK506-binding protein 3 (FPR3)

Sign In for Pricing
View Details