Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Capsule polysaccharide export inner-membrane protein BexB (bexB)

This Recombinant Capsule polysaccharide export inner-membrane protein BexB (bexB) spans the amino acid sequence from region 1-265.

Product Specifications

Product Name Alternative

Capsule polysaccharide export inner-membrane protein BexB

UniProt

P19390

Expression Region

1-265

Origin

Haemophilus influenzae

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQYGDKTTFKQSLAIQGRVINALLMREIITRYGRQNIGFFWLFVEPLLMTFFIVMMWKFI RADKFSTLNMIAFVMTGYPMAMMWRNASNRAIGSISANLSLLYHRNVRVLDTIFTRVLLE VAGASIAQILFMAILVMIDWIDAPHDVFYMLIAWFLMAMFAFGLGLIICAIAQQFDVFGK IWGTLSFVLLPISGAFFFVHNLPAQAQSIALWFPMIHGTEMFRHGYFGDTVVTYESIGFL VVSDLALLLLGLVMVKNFSKGVEPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Urotensin II (Frog)
orb372904-01 1 mg

Urotensin II (Frog)

Sign In for Pricing
View Details
Urotensin II (Frog)
orb372904-02 5 mg

Urotensin II (Frog)

Sign In for Pricing
View Details
Urotensin II (Frog)
orb372904-03 10 mg

Urotensin II (Frog)

Sign In for Pricing
View Details
Recombinant Human MHC Class I Polypeptide-Related Sequence A Protein
ARP4854-01 10 µg

Recombinant Human MHC Class I Polypeptide-Related Sequence A Protein

Sign In for Pricing
View Details
Recombinant Human MHC Class I Polypeptide-Related Sequence A Protein
ARP4854-02 50 µg

Recombinant Human MHC Class I Polypeptide-Related Sequence A Protein

Sign In for Pricing
View Details
Recombinant Human MHC Class I Polypeptide-Related Sequence A Protein
ARP4854-03 100 µg

Recombinant Human MHC Class I Polypeptide-Related Sequence A Protein

Sign In for Pricing
View Details