Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Capsule polysaccharide export inner-membrane protein BexB (bexB)

This Recombinant Capsule polysaccharide export inner-membrane protein BexB (bexB) spans the amino acid sequence from region 1-265.

Product Specifications

Product Name Alternative

Capsule polysaccharide export inner-membrane protein BexB

UniProt

P22235

Expression Region

1-265

Origin

Haemophilus influenzae

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQYGDKTTFKQSLAIQGRVINALLMREIITRYGRQNIGFFWLFVEPLLMTFFIVMMWKFI RADKFSTLNMIAFVMTGYPMAMMWRNASNRAIGSISANLSLLYHRNVRVLDTIFTRVLLE VAGASIAQILFMAILVMIDWIDAPHDVFYMLIAWFLMAMFAFALGLIICAIAQQFDVFGK IWGTLSFVLLPISGAFFFVHNLPAQAQSIALWFPMIHGTEMFRHGYFGDTVVTYESIGFL VVSDLALLLLGLVMVKNFSKGVEPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

General Purpose Incubator BIGP-7703
BIGP-7703 1 Unit

General Purpose Incubator BIGP-7703

Sign In for Pricing
View Details
DARPP32 (PPP1R1B) Human Gene Knockout Kit (CRISPR)
KN400916 1 Kit

DARPP32 (PPP1R1B) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
10X ViBuffer S, 5 x 1ml
RB0203 5x 1 mL

10X ViBuffer S, 5 x 1ml

Sign In for Pricing
View Details
Perp (NM_022032) Mouse Tagged ORF Clone
MG201877 10 µg

Perp (NM_022032) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CD62E Rabbit Polyclonal Antibody
0805-6 100 µL

CD62E Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human IL-6, Tag Free
HA210797-01 20 µg

Human IL-6, Tag Free

Sign In for Pricing
View Details