Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Capsule polysaccharide export inner-membrane protein BexB (bexB)

This Recombinant Capsule polysaccharide export inner-membrane protein BexB (bexB) spans the amino acid sequence from region 1-265.

Product Specifications

Product Name Alternative

Capsule polysaccharide export inner-membrane protein BexB

UniProt

P19391

Expression Region

1-265

Origin

Haemophilus influenzae

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQYGDQTTFKQSLAIQGRVINALLMREIITRYGRKNIGFLWLFVEPLLMTFFIVMMWKFI RADKFSTLNMIAFVMTGYPMAMMWRNASNRAIGSISANLSLLYHRNVRVLDTIFTRVLLE VAGASIAQILFMAVLVLIGWIDAPRDVFYMLMAWFLMAMFAFALGLIICAVAQQFDVFGK IWGTLSFVLLPISGAFFFVHNLPSQAQSIALWLPMIHGTEMFRHGYFGDTVVTYESIGFL VVSDLALLLMGLVMVKNFSKGIEPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gadd45a (NM_007836) Mouse Tagged ORF Clone
MG201332 10 µg

Gadd45a (NM_007836) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
GAPDH Antibody
KC-2172-01 50 μL

GAPDH Antibody

Sign In for Pricing
View Details
GAPDH Antibody
KC-2172-02 100 µL

GAPDH Antibody

Sign In for Pricing
View Details
GAPDH Antibody
KC-2172-03 1 mL

GAPDH Antibody

Sign In for Pricing
View Details
NNMT Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2G8]
TA502522BM 100 µL

NNMT Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2G8]

Sign In for Pricing
View Details
Human RHEX activation kit by CRISPRa
GA118475 1 Kit

Human RHEX activation kit by CRISPRa

Sign In for Pricing
View Details