Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Capsule polysaccharide export inner-membrane protein BexB (bexB)

This Recombinant Capsule polysaccharide export inner-membrane protein BexB (bexB) spans the amino acid sequence from region 1-265.

Product Specifications

Product Name Alternative

Capsule polysaccharide export inner-membrane protein BexB

UniProt

P19391

Expression Region

1-265

Origin

Haemophilus influenzae

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQYGDQTTFKQSLAIQGRVINALLMREIITRYGRKNIGFLWLFVEPLLMTFFIVMMWKFI RADKFSTLNMIAFVMTGYPMAMMWRNASNRAIGSISANLSLLYHRNVRVLDTIFTRVLLE VAGASIAQILFMAVLVLIGWIDAPRDVFYMLMAWFLMAMFAFALGLIICAVAQQFDVFGK IWGTLSFVLLPISGAFFFVHNLPSQAQSIALWLPMIHGTEMFRHGYFGDTVVTYESIGFL VVSDLALLLMGLVMVKNFSKGIEPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S100B (Astrocyte and Melanoma Marker) (S100B/1706R), 0.2mg/mL
BNUB1706-100 1x 100 µL

S100B (Astrocyte and Melanoma Marker) (S100B/1706R), 0.2mg/mL

Sign In for Pricing
View Details
TRAcP (Tartrate-Resistant Acid Phosphatase) (Hairy Cell Leukemia Marker) (rACP5/1070), CF640R conjugate, 0.1mg/mL
BNC402337-100 1x 100 µL

TRAcP (Tartrate-Resistant Acid Phosphatase) (Hairy Cell Leukemia Marker) (rACP5/1070), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse H-2 Antibody[M1/42]
E-AB-F1216UI-01 25 µg

PE/Cyanine5.5 Anti-Mouse H-2 Antibody[M1/42]

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse H-2 Antibody[M1/42]
E-AB-F1216UI-02 100 µg

PE/Cyanine5.5 Anti-Mouse H-2 Antibody[M1/42]

Sign In for Pricing
View Details
Ep-CAM / CD326 (Rat) (GZ-20), CF594 conjugate, 0.1mg/mL
BNC940382-500 1x 500 µL

Ep-CAM / CD326 (Rat) (GZ-20), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/1775R), CF594 conjugate, 0.1mg/mL
BNC941775-500 1x 500 µL

CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/1775R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details