Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Neisseria meningitidis serogroup B Capsule polysaccharide export inner-membrane protein CtrC (ctrC)

This Recombinant Neisseria meningitidis serogroup B Capsule polysaccharide export inner-membrane protein CtrC (ctrC) spans the amino acid sequence from region 1-265.

Product Specifications

Product Name Alternative

Capsule polysaccharide export inner-membrane protein CtrC

UniProt

P32015

Expression Region

1-265

Origin

Neisseria meningitidis serogroup B (strain MC58)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKALHKTSFWESLAIQRRVIGALLMREIITRYGRNNIGFLWLFVEPLLMTFVIVLMWKFL RADRYSTLNIVAFAITGYPMLMMWRNASKRAVGSISSNASLLYHRNVRVLDTILARMILE IAGATIAQIVIMAVLIAIGWIEMPADMFYMLMAWLLMAFFAIGLGLVICSIAFNFEPFGK IWGTLTFVMMPLSGAFFFVHNLPPKVQEYALMIPMVHGTEMFRAGYFGSDVITYENPWYI VLCNLVLLLFGLAMVSKFSKGVEPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD5 (Cris-1), CF647 conjugate, 0.1mg/mL
BNC470176-500 1x 500 µL

CD5 (Cris-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF740 conjugate, 0.1mg/mL
BNC740304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF405S conjugate, 0.1mg/mL
BNC040152-500 1x 500 µL

CD11c (HC1/1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF488A conjugate, 0.1mg/mL
BNC880012-500 1x 500 µL

Tyrosinase (T311), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (KLC709), CF640R conjugate, 0.1mg/mL
BNC400709-500 1x 500 µL

Human Kappa Light Chain (KLC709), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
STAT3 / Signal Transducer and Activator of Transcription 3 (PCRP-STAT3-2F12), CF568 conjugate, 0.1mg/mL
BNC681907-100 1x 100 µL

STAT3 / Signal Transducer and Activator of Transcription 3 (PCRP-STAT3-2F12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details