Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arthrobacter sp. ATP synthase subunit a (atpB)

This Recombinant Arthrobacter sp. ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-266.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A0JY70

Expression Region

1-266

Origin

Arthrobacter sp. (strain FB24)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIALALPAQDSGEFNPPGIEEMHLPAILPWGAADGFSKQMLLVILSVVIIATFFLLAARK QQLVPGKLQFAGEAAYGFVRNSIAKDIIGGKDFMKYVPLLFSLFFFILVNNIYGAIPLIQ LPSFSHVGGAYVLAAIVYLTWIAIGVKKNGIKYFKLATVPTGVPVYILPIVIPIEIISNF LVRPVTHSLRLFATMLAGHLIVMIAGSGIEYLVMQENILLKGTSVLVLVGAIAMYMLEAL IMALQAYVFTLLTAIYIEGALHADSH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BRCA2 Rabbit pAb, FITC conjugated
orb3000821 100 µL

BRCA2 Rabbit pAb, FITC conjugated

Sign In for Pricing
View Details
Olfr1459 3'UTR Luciferase Stable Cell Line
TU114943 1.0 mL

Olfr1459 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
FNDC5 Rabbit mAb
C05980-100uL 100 µL

FNDC5 Rabbit mAb

Sign In for Pricing
View Details
Cluster Of Differentiation 4
545982 200 µL

Cluster Of Differentiation 4

Sign In for Pricing
View Details
RGS4 Recombinant Protein (Mouse)
RP167915 100 µg

RGS4 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
CCDC146, NT (CCDC146, KIAA1505, Coiled-coil domain-containing protein 146) (MaxLight 650) discontinued
033303-ML650 100 µL

CCDC146, NT (CCDC146, KIAA1505, Coiled-coil domain-containing protein 146) (MaxLight 650) discontinued

Sign In for Pricing
View Details