Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arthrobacter aurescens ATP synthase subunit a (atpB)

This Recombinant Arthrobacter aurescens ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-266.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A1R7V8

Expression Region

1-266

Origin

Arthrobacter aurescens (strain TC1)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIALALPAQDSGSFTPPGIDEMHLPAILPWGAHDGFSKQMLLVILSVVIIATFFILAARK QQLVPGKLQFAGEMAYGFVRNGIAKDIIGGKDFIKYVPLLFSLFFFILVNNIYGAIPVIQ LPSFSHVGGAYVMAGIVYFTWIIIGIKKNGLKYFKLATVPSGVPWYILPIVVPIEIISNF LVRPVTHSLRLFATMLAGHLIVMLAGSGIEFLVMQENVLLKGASVLVLVGAVAMYMLEAL IMALQAYVFTLLTAIYIEGALHADSH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rnf32 Rat shRNA Plasmid (Locus ID 311936)
TR701604 1 Kit

Rnf32 Rat shRNA Plasmid (Locus ID 311936)

Sign In for Pricing
View Details
TXNDC5 293 Cell Lysate
405871 0.1 mg

TXNDC5 293 Cell Lysate

Sign In for Pricing
View Details
Interferon gamma/IFNG Rabbit Polyclonal Antibody (Carrier-free)
orb3079160 100 µg

Interferon gamma/IFNG Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
LIPG Antibody
OAAL00450-100UG 100 µg

LIPG Antibody

Sign In for Pricing
View Details
Fam69a sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
20086116 3x 1.0 µg

Fam69a sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
POGK Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6D5]
TA505607BM 100 µL

POGK Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6D5]

Sign In for Pricing
View Details