Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arthrobacter aurescens ATP synthase subunit a (atpB)

This Recombinant Arthrobacter aurescens ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-266.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A1R7V8

Expression Region

1-266

Origin

Arthrobacter aurescens (strain TC1)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIALALPAQDSGSFTPPGIDEMHLPAILPWGAHDGFSKQMLLVILSVVIIATFFILAARK QQLVPGKLQFAGEMAYGFVRNGIAKDIIGGKDFIKYVPLLFSLFFFILVNNIYGAIPVIQ LPSFSHVGGAYVMAGIVYFTWIIIGIKKNGLKYFKLATVPSGVPWYILPIVVPIEIISNF LVRPVTHSLRLFATMLAGHLIVMLAGSGIEFLVMQENVLLKGASVLVLVGAVAMYMLEAL IMALQAYVFTLLTAIYIEGALHADSH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TROVE2 Antibody, HRP conjugated
A45412-50UG 50 µg

TROVE2 Antibody, HRP conjugated

Sign In for Pricing
View Details
Rabbit Anti-TRIM16L antibody
SL16726R-01 50 µL

Rabbit Anti-TRIM16L antibody

Sign In for Pricing
View Details
Rabbit Anti-TRIM16L antibody
SL16726R-02 100 µL

Rabbit Anti-TRIM16L antibody

Sign In for Pricing
View Details
Cd300e sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
15523114 3x 1.0 µg

Cd300e sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
RPS4Y1 Antibody
E38PA2028 100 µL

RPS4Y1 Antibody

Sign In for Pricing
View Details
Recombinant Human WD and tetratricopeptide repeats protein 1
orb1907063-01 50 µg

Recombinant Human WD and tetratricopeptide repeats protein 1

Sign In for Pricing
View Details