Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arthrobacter chlorophenolicus ATP synthase subunit a (atpB)

This Recombinant Arthrobacter chlorophenolicus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-266.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

B8HAZ5

Expression Region

1-266

Origin

Arthrobacter chlorophenolicus (strain A6 / ATCC 700700 / DSM 12829 / JCM 12360)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIALALPAQDSGEFTPPGINEMHLPAILPWGAAEGFSKQMLLVLLSVVFIAVFFVLAARK QQLVPGKLQFAGEAAYGFVRNGIAKDIIGGRDFIKYVPLLFSLFFFILVNNIYGAIPLIQ LPTFSHVGGAYVLAGIVYFTWIAIGIKKNGLRYFKLATVPSGVPWFILPIVIPIEIISNF VVRPVTHSLRLFATMLAGHLIVMIAGSGIEYLVMQESILLKGTSVLVLAGAIAMYMLEAL IMVLQAYVFTLLTAIYIEGALHADSH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti Chicken IgY (H&L) -AbFluor 680
SA1029-01 100 µL

Anti Chicken IgY (H&L) -AbFluor 680

Sign In for Pricing
View Details
Anti Chicken IgY (H&L) -AbFluor 680
SA1029-02 1 mL

Anti Chicken IgY (H&L) -AbFluor 680

Sign In for Pricing
View Details
Human XK-related protein 4 (XKR4) ELISA Kit
abx553693 96 Tests

Human XK-related protein 4 (XKR4) ELISA Kit

Sign In for Pricing
View Details
Rabbit Monoclonal IGFBP-3 Antibody (010) [DyLight 405]
NBP2-89496V 0.1 mL

Rabbit Monoclonal IGFBP-3 Antibody (010) [DyLight 405]

Sign In for Pricing
View Details
Anti-PDP2 Antibody
A12472 100 µL

Anti-PDP2 Antibody

Sign In for Pricing
View Details
ERBB4 Mouse Monoclonal Antibody
AMM81442-01 1 Each

ERBB4 Mouse Monoclonal Antibody

Sign In for Pricing
View Details