Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arthrobacter chlorophenolicus ATP synthase subunit a (atpB)

This Recombinant Arthrobacter chlorophenolicus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-266.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

B8HAZ5

Expression Region

1-266

Origin

Arthrobacter chlorophenolicus (strain A6 / ATCC 700700 / DSM 12829 / JCM 12360)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIALALPAQDSGEFTPPGINEMHLPAILPWGAAEGFSKQMLLVLLSVVFIAVFFVLAARK QQLVPGKLQFAGEAAYGFVRNGIAKDIIGGRDFIKYVPLLFSLFFFILVNNIYGAIPLIQ LPTFSHVGGAYVLAGIVYFTWIAIGIKKNGLRYFKLATVPSGVPWFILPIVIPIEIISNF VVRPVTHSLRLFATMLAGHLIVMIAGSGIEYLVMQESILLKGTSVLVLAGAIAMYMLEAL IMVLQAYVFTLLTAIYIEGALHADSH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken C C motif chemokine 26 (CCL26) ELISA kit
GTR10449744 96 Well

Chicken C C motif chemokine 26 (CCL26) ELISA kit

Sign In for Pricing
View Details
CDK11B Rabbit pAb
A12830-01 20 µL

CDK11B Rabbit pAb

Sign In for Pricing
View Details
CDK11B Rabbit pAb
A12830-02 100 μL

CDK11B Rabbit pAb

Sign In for Pricing
View Details
CDK11B Rabbit pAb
A12830-03 500 μL

CDK11B Rabbit pAb

Sign In for Pricing
View Details
CDK11B Rabbit pAb
A12830-04 1000 μL

CDK11B Rabbit pAb

Sign In for Pricing
View Details
47 literLN2 Storage Dewar with 10 stock canisters (ICB47-10)
TW-ICB47-10 1 Unit

47 literLN2 Storage Dewar with 10 stock canisters (ICB47-10)

Sign In for Pricing
View Details