Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mannose permease IIC component (manY)

This Recombinant Mannose permease IIC component (manY) spans the amino acid sequence from region 1-266.

Product Specifications

Product Name Alternative

Mannose permease IIC component, EII-P-Man, EIIC-Man, PTS system mannose-specific EIIC component

UniProt

P69804

Expression Region

1-266

Origin

Shigella flexneri

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEITTLQIVLVFIVACIAGMGSILDEFQFHRPLIACTLVGIVLGDMKTGIIIGGTLEMIA LGWMNIGAAVAPDAALASIISTILVIAGHQSIGAGIALAIPLAAAGQVLTIIVRTITVAF QHAADKAADNGNLTAISWIHVSSLFLQAMRVAIPAVIVALSVGTSEVQNMLNAIPEVVTN GLNIAGGMIVVVGYAMVINMMRAGYLMPFFYLGFVTAAFTNFNLVALGVIGTVMAVLYIQ LSPKYNRVAGAPAQAAGNNDLDNELD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Carm1 Antibody (CARM1/7426) [PE]
NBP3-20909PE 0.1 mL

Mouse Monoclonal Carm1 Antibody (CARM1/7426) [PE]

Sign In for Pricing
View Details
RNF36 (TRIM69) Human Over-expression Lysate
orb1372658 20 µg

RNF36 (TRIM69) Human Over-expression Lysate

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Thyroid Stimulating Hormone Beta (TSHb)
MBS2120214-01 0.1 mL

APC-Linked Polyclonal Antibody to Thyroid Stimulating Hormone Beta (TSHb)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Thyroid Stimulating Hormone Beta (TSHb)
MBS2120214-02 0.2 mL

APC-Linked Polyclonal Antibody to Thyroid Stimulating Hormone Beta (TSHb)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Thyroid Stimulating Hormone Beta (TSHb)
MBS2120214-03 0.5 mL

APC-Linked Polyclonal Antibody to Thyroid Stimulating Hormone Beta (TSHb)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Thyroid Stimulating Hormone Beta (TSHb)
MBS2120214-04 1 mL

APC-Linked Polyclonal Antibody to Thyroid Stimulating Hormone Beta (TSHb)

Sign In for Pricing
View Details