Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mannose permease IIC component (manY)

This Recombinant Mannose permease IIC component (manY) spans the amino acid sequence from region 1-266.

Product Specifications

Product Name Alternative

Mannose permease IIC component, EII-P-Man, EIIC-Man, PTS system mannose-specific EIIC component

UniProt

P69803

Expression Region

1-266

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEITTLQIVLVFIVACIAGMGSILDEFQFHRPLIACTLVGIVLGDMKTGIIIGGTLEMIA LGWMNIGAAVAPDAALASIISTILVIAGHQSIGAGIALAIPLAAAGQVLTIIVRTITVAF QHAADKAADNGNLTAISWIHVSSLFLQAMRVAIPAVIVALSVGTSEVQNMLNAIPEVVTN GLNIAGGMIVVVGYAMVINMMRAGYLMPFFYLGFVTAAFTNFNLVALGVIGTVMAVLYIQ LSPKYNRVAGAPAQAAGNNDLDNELD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat KRT20 Protein, His (Fc)-Avi-tagged
KRT20-2974R 50 µg

Recombinant Rat KRT20 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
POP4 (NM_006627) Human Tagged ORF Clone Lentiviral Particle
RC202898L1V 200 µL

POP4 (NM_006627) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Neurotrophin 3 (NTF3) (NM_001102654) Human Tagged ORF Clone Lentiviral Particle
RC214281L4V 200 µL

Neurotrophin 3 (NTF3) (NM_001102654) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human Cytidine Monophosphate N-Acetylneuraminic Acid Synthetase (CMAS) ELISA Kit
abx384762 96 Tests

Human Cytidine Monophosphate N-Acetylneuraminic Acid Synthetase (CMAS) ELISA Kit

Sign In for Pricing
View Details
TCF15 Protein Vector (Rat) (pPM-C-HA)
PV310132 500 ng

TCF15 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Anti-LUC | Luciferase (IgG fraction)
AS20 4479 10 mg

Anti-LUC | Luciferase (IgG fraction)

Sign In for Pricing
View Details