Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gibberella zeae Rhomboid protein 2 (RBD2)

This Recombinant Gibberella zeae Rhomboid protein 2 (RBD2) spans the amino acid sequence from region 1-267.

Product Specifications

Product Name Alternative

Rhomboid protein 2, EC= 3.4.21.-

UniProt

Q4I4A4

Expression Region

1-267

Origin

Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) (Wheat head blight fungus) (Fusarium graminearum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRPRLQNFNALRARSYLTRLPLFTRLIVLAIIALSIASLQSVWNLREWGALIPEEISITN AYRLSTFPLIHLNVIHAILNLLALTPLMERFETEHGTLTSLALFFGPLTSIPAVAYVLIE RCIFRANHGVLGASMWVFTLLAMESIQTYKSNPHFVIGSVNIPTWTTPLIMSLVVAALIP GTSLLGHLCGIAIGYVAGFGYAKLLAPPEWGLRWVENRLNLLKILPHYVSIDKTTYGRFG VLPTTNRPGPSGSAATELVGTTQRLGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRAK (MAPKAPK5) Mouse Monoclonal Antibody [Clone ID: OTI1H3]
CF804230 100 µg

PRAK (MAPKAPK5) Mouse Monoclonal Antibody [Clone ID: OTI1H3]

Sign In for Pricing
View Details
Human BZW2 activation kit by CRISPRa
GA109177 1 Kit

Human BZW2 activation kit by CRISPRa

Sign In for Pricing
View Details
2-Mercaptoisobutyric Acid, 90%
TRC-M253400-10G 10 g

2-Mercaptoisobutyric Acid, 90%

Sign In for Pricing
View Details
Bis(triphenylphosphine)nickel(II) Dichloride
TRC-B588700-25G 25 g

Bis(triphenylphosphine)nickel(II) Dichloride

Sign In for Pricing
View Details
Tissue FFPE Sections, Muscle tissue
CS705523 5x 5 µm

Tissue FFPE Sections, Muscle tissue

Sign In for Pricing
View Details
L-Lysine acetate
TRC-L488778-2.5G 2.5 g

L-Lysine acetate

Sign In for Pricing
View Details