Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gibberella zeae Rhomboid protein 2 (RBD2)

This Recombinant Gibberella zeae Rhomboid protein 2 (RBD2) spans the amino acid sequence from region 1-267.

Product Specifications

Product Name Alternative

Rhomboid protein 2, EC= 3.4.21.-

UniProt

Q4I4A4

Expression Region

1-267

Origin

Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) (Wheat head blight fungus) (Fusarium graminearum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRPRLQNFNALRARSYLTRLPLFTRLIVLAIIALSIASLQSVWNLREWGALIPEEISITN AYRLSTFPLIHLNVIHAILNLLALTPLMERFETEHGTLTSLALFFGPLTSIPAVAYVLIE RCIFRANHGVLGASMWVFTLLAMESIQTYKSNPHFVIGSVNIPTWTTPLIMSLVVAALIP GTSLLGHLCGIAIGYVAGFGYAKLLAPPEWGLRWVENRLNLLKILPHYVSIDKTTYGRFG VLPTTNRPGPSGSAATELVGTTQRLGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® 700 Anti-Human CD46 Antibody[TRA-2-10]
AN00324M1-01 20 Tests

Elab Fluor® 700 Anti-Human CD46 Antibody[TRA-2-10]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD46 Antibody[TRA-2-10]
AN00324M1-02 100 Tests

Elab Fluor® 700 Anti-Human CD46 Antibody[TRA-2-10]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD46 Antibody[TRA-2-10]
AN00324M1-03 2x 100 Tests

Elab Fluor® 700 Anti-Human CD46 Antibody[TRA-2-10]

Sign In for Pricing
View Details
Erythropoietin (EPO) (Marker of Placentation Disorders) (EPO/3793R), CF405S conjugate, 0.1mg/mL
BNC043793-100 1x 100 µL

Erythropoietin (EPO) (Marker of Placentation Disorders) (EPO/3793R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C12orf74 (NM_001178097) Human Over-expression Lysate
LY432634 100 µg

C12orf74 (NM_001178097) Human Over-expression Lysate

Sign In for Pricing
View Details
YY1 Recombinant Rabbit Monoclonal Antibody [SY29-01]
ET1605-40 100 µL

YY1 Recombinant Rabbit Monoclonal Antibody [SY29-01]

Sign In for Pricing
View Details