Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat DNA damage-regulated autophagy modulator protein 2 (Dram2)

This Recombinant Rat DNA damage-regulated autophagy modulator protein 2 (Dram2) spans the amino acid sequence from region 1-267.

Product Specifications

Product Name Alternative

DNA damage-regulated autophagy modulator protein 2, Transmembrane protein 77

UniProt

Q5BK09

Expression Region

1-267

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWWFQQGLSFLPSALVIWTFATFIFSYITAITLHHVDPALPYISDTGTMPPERCLFGVML NIAAVLGIATIYVRYKQVHALNPEENLIIKLNKAGLVLGILSCLGLSLVANFQKSALFIV HVCGAVLAFSMGSFYMFVQTILSYQMQPKIHSKQVFWVRLLLVIWCGVSALSMMTCSSIL YSSDFGADIVQKLHWNPEDKGYVLHIVTTAAEWSMSFSFFGFFLTYIRDFQKITLRVEAN LHGLTLYDTVPCPVTNERTPLLSRDFQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aluminum Oxide (Activated, Basic, Brockmann I)
TRC-A575717-250G 250 g

Aluminum Oxide (Activated, Basic, Brockmann I)

Sign In for Pricing
View Details
FGF14 Human Gene Knockout Kit (CRISPR)
KN419002 1 Kit

FGF14 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RAI2 (NM_001172743) Human Over-expression Lysate
LC433236 20 µg

RAI2 (NM_001172743) Human Over-expression Lysate

Sign In for Pricing
View Details
Emerin (Papillary Thyroid Carcinoma and EDMD Marker) (EMD/2167), CF647 conjugate, 0.1mg/mL
BNC472167-500 1x 500 µL

Emerin (Papillary Thyroid Carcinoma and EDMD Marker) (EMD/2167), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Aox4 Mouse Gene Knockout Kit (CRISPR)
KN501349 1 Kit

Aox4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
OR13H1 Antibody
8G512-AAT 50 µg

OR13H1 Antibody

Sign In for Pricing
View Details