Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat DNA damage-regulated autophagy modulator protein 2 (Dram2)

This Recombinant Rat DNA damage-regulated autophagy modulator protein 2 (Dram2) spans the amino acid sequence from region 1-267.

Product Specifications

Product Name Alternative

DNA damage-regulated autophagy modulator protein 2, Transmembrane protein 77

UniProt

Q5BK09

Expression Region

1-267

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWWFQQGLSFLPSALVIWTFATFIFSYITAITLHHVDPALPYISDTGTMPPERCLFGVML NIAAVLGIATIYVRYKQVHALNPEENLIIKLNKAGLVLGILSCLGLSLVANFQKSALFIV HVCGAVLAFSMGSFYMFVQTILSYQMQPKIHSKQVFWVRLLLVIWCGVSALSMMTCSSIL YSSDFGADIVQKLHWNPEDKGYVLHIVTTAAEWSMSFSFFGFFLTYIRDFQKITLRVEAN LHGLTLYDTVPCPVTNERTPLLSRDFQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C7orf53 (LSMEM1) Human Gene Knockout Kit (CRISPR)
KN423802 1 Kit

C7orf53 (LSMEM1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (rDG1/447), 0.2mg/mL
BNUB1869-500 1x 500 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (rDG1/447), 0.2mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS801459 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Manganese Sulfate Monohydrate
TRC-M164320-50G 50 g

Manganese Sulfate Monohydrate

Sign In for Pricing
View Details
Apc11 (ANAPC11) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3C4]
TA506325AM 100 µL

Apc11 (ANAPC11) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3C4]

Sign In for Pricing
View Details
Calpastatin (CAST/1550), Biotin conjugate, 0.1mg/mL
BNCB1550-100 1x 100 µL

Calpastatin (CAST/1550), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details