Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat DNA damage-regulated autophagy modulator protein 2 (Dram2)

This Recombinant Rat DNA damage-regulated autophagy modulator protein 2 (Dram2) spans the amino acid sequence from region 1-267.

Product Specifications

Product Name Alternative

DNA damage-regulated autophagy modulator protein 2, Transmembrane protein 77

UniProt

Q5BK09

Expression Region

1-267

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWWFQQGLSFLPSALVIWTFATFIFSYITAITLHHVDPALPYISDTGTMPPERCLFGVML NIAAVLGIATIYVRYKQVHALNPEENLIIKLNKAGLVLGILSCLGLSLVANFQKSALFIV HVCGAVLAFSMGSFYMFVQTILSYQMQPKIHSKQVFWVRLLLVIWCGVSALSMMTCSSIL YSSDFGADIVQKLHWNPEDKGYVLHIVTTAAEWSMSFSFFGFFLTYIRDFQKITLRVEAN LHGLTLYDTVPCPVTNERTPLLSRDFQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Androgen Receptor Antibody
RC-17015-01 50 μL

Recombinant Androgen Receptor Antibody

Sign In for Pricing
View Details
Recombinant Androgen Receptor Antibody
RC-17015-02 100 µL

Recombinant Androgen Receptor Antibody

Sign In for Pricing
View Details
Recombinant Androgen Receptor Antibody
RC-17015-03 1 mL

Recombinant Androgen Receptor Antibody

Sign In for Pricing
View Details
Cebpz (620-633) Goat Polyclonal Antibody
AP32065PU-N 100 µg

Cebpz (620-633) Goat Polyclonal Antibody

Sign In for Pricing
View Details
INSM1 (NM_002196) Human Over-expression Lysate
LC419479 20 µg

INSM1 (NM_002196) Human Over-expression Lysate

Sign In for Pricing
View Details
GRP94 Antibody
SPC-101S 12 µg

GRP94 Antibody

Sign In for Pricing
View Details