Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Raphus cucullatus Cytochrome b (MT-CYB)

This Recombinant Raphus cucullatus Cytochrome b (MT-CYB) spans the amino acid sequence from region 1-267.

Product Specifications

Product Name Alternative

Cytochrome b, Complex III subunit 3, Complex III subunit III, Cytochrome b-c1 complex subunit 3, Ubiquinol-cytochrome-c reductase complex cytochrome b subunit

UniProt

Q8SG72

Expression Region

1-267

Origin

Raphus cucullatus (Dodo)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

WWNFGSLLGICLMTQILTGLLLAAHYTADTTLAFSSVAHTCRDVQYGWLIRNLHANGASF FFICIYLHIGRGLYYGSYLYKETWNTGVILLLTLMATAFVGYVLPWGQMSFWGATVITNL FSAIPYIGQTIVEWAWGGFSVDNPTLTRFFTLHFLLPFMIAGLTIIHLTFLHESGSNNPL GISSNCDKIPFHPYFSLKDILGFTLMFLPLMTLALFAPNLLGDPENFTPANPLVTPPHIK PEWYFLFAYAILRSIPNKLGGVLALAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ODF3 activation kit by CRISPRa
GA114416 1 Kit

Human ODF3 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human GSK3B Protein (His Tag)
PKSH030425 50 µg

Recombinant Human GSK3B Protein (His Tag)

Sign In for Pricing
View Details
Frozen Tissue Sections, Stomach
CS503847 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details
Cckbr Mouse Gene Knockout Kit (CRISPR)
KN502776 1 Kit

Cckbr Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
p53 DINP1 Recombinant Rabbit Monoclonal Antibody [JG37-64]
ET7108-35 100 µL

p53 DINP1 Recombinant Rabbit Monoclonal Antibody [JG37-64]

Sign In for Pricing
View Details
MALT-1 (MT1/410), CF488A conjugate, 0.1mg/mL
BNC880410-500 1x 500 µL

MALT-1 (MT1/410), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details